1
0
0
(1 - 22 von 27
)
IMDB Filmographie: With Rialto Productions (Sorted by Popularity Ascending) - IMDbwww.imdb.com › company
With Rialto Productions (Sorted by Popularity Ascending) ; 1. Dreams of the Rarebit Fiend: The Flying House · 11 min | Animation, Short ; 2. Dreams of the Rarebit ...
Flip's Circus (S) (1921) - FilmAffinity
www.filmaffinity.com
Rialto Productions. Genre: Animation. Comedy | Circus. Silent Film. Short Film (Animated). Movie Soulmates' ratings. Register so you can access movie ...
Gertie on Tour (S) (1921) - FilmAffinity
www.filmaffinity.com
McCay / Rialto Productions. Genre: Animation Comedy Dinosaurs Silent Film Sequel Short Film (Animated). Related Movies 1. Sequel of: Gertie the Dinosaur (S).
Gertie on Tour (C) (1921) - FilmAffinity
www.filmaffinity.com
Música. Película muda. Fotografía. Animation (B&W). Productora. McCay / Rialto Productions. Género: Animación Comedia Dinosaurios Cine ...
The Centaurs (S) (1921) - FilmAffinity
www.filmaffinity.com
Silent film. Cinematography. Animation (B&W). Cast: Animation; Producer. Rialto Productions. Genre: Animation. Fantasy. Romance | Mythology. Silent Film.
Anne Cook – Page 2
annecookhomes.home.blog
Gruppe : Tanzfilm, Wellenreiten, Oper – Fantasy, Animation. Produktionsland : Lesotho. Korporation : Bizum Comunicação – Rialto Productions.
Origins of American Animation, Available Online, Rialto Productions |...
www.loc.gov
Search results of 3.
The Centaurs, a Fragment (1921) – The Public Domain Review
publicdomainreview.org
The only surviving fragment of Winsor McCay’s now lost The Centaurs, produced in by Rialto Productions.The animation is notable for it’s particular quality of line and movement way ahead of its time (20 years before Disney would reach such heights with Fantasia) and for a strange little moment when one of the centaurs strikes down a bird with a stone for seemingly no reason.
Gertie on Tour (1921) - Trakt.tvtrakt.tv › movies › gertie-on-tour-1921
trakt.tv
Bewertung 52 % (5) ... English; Studios Rialto Productions + 1 more, McCay; Genres Animation, Comedy, Fantasy; Links IMDB, TMDB, Fanart.tv, JustWatch, Wikipedia, Refresh Data. Bewertung 52 % (5) ... English; Studios Rialto Productions + 1 more, McCay; Genres Animation, Comedy, Fantasy; Links IMDB, TMDB, Fanart.tv, JustWatch, Wikipedia, Refresh Data.
Cracked Ice - Silent Erawww.silentera.com › PSFL › data › CrackedIce1922
www.silentera.com
AP · Essanay Film Manufacturing Company production; distributed by Rialto Productions. / Scenario by Howard S. Moss. Animation by Howard S. Moss ...
Douchebag centaur kills bird with stone for no reasonboingboing.net › › douchebag-centaur-...
boingboing.net
AP · by Rialto Productions. The animation is notable for it's particular quality of line and movement way ahead of its time (20 years…
Dreams of the Rarebit Fiend: Bug Vaudeville (animation movie, 1921)en.kinorium.com › ...
en.kinorium.com
Rialto Productions. Also Known As. Bug Vaudeville (United States). Description. After eating a cheese cake, a hobo falls asleep and dreams of a vaudeville show ...
Winsor McCay | Rarebit Early Animation Wiki
rarebit.org
In the early 20's, with the assistance of his son Robert, McCay produced and animated his comic stripe, Dreams of the Rarebit Fiend for Rialto Productions.
Origins of American Animation,
www.merlot.org
... Motion Picture Co., John Fitzsimmons, U.S., Wallace Carlson, Harry S. Palmer, Willis O'Brien, John McCay, Rialto Productions, Vitagraph.
The Origins of American Animation - Silent Cinema Salon - Philip Carliphilipcarli.com › the-origins-of-american-animation
philipcarli.com
Contributor: McCay, John – McCay, Winsor – Rialto Productions – Fitzsimmons, John A. Date: Dud leaves home. Dud wants to buy his girlfriend Maime an ice ...
"The Centaur" - Animation from Animated Film Reviewsanimatedfilmreviews.filminspector.com ›
animatedfilmreviews.filminspector.com
· The only surviving fragment of Winsor McCay's now lost The Centaurs, produced in by Rialto Productions. The animation is notable for it's ...
The Appendix Tumblr | “The only surviving fragment of Winsor McCay’s...
tumblr.theappendix.net
“The only surviving fragment of Winsor McCay’s now lost The Centaurs, produced in by Rialto Productions. The animation is notable for it’s particular...
[Gertie on tour--excerpts] / - Drawing. Public domain image. - PICRYLpicryl.com › Public Domain Media
picryl.com
Fitzsimmons, John A., animation. Rialto Productions. AFI/Cinémathèque canadienne Collection (Library of Congress). create. Source. Library ...
The Appendix Tumblrtumblr.theappendix.net › page
tumblr.theappendix.net
· “The only surviving fragment of Winsor McCay's now lost The Centaurs, produced in by Rialto Productions. The animation is notable for ...
Silent Era : Progressive Silent Film List
www.silentera.com
The Centaurs (191?) American B&W : Short film. Directed by Winsor McCay. Cast: (unknown). Rialto Productions production. / Animation by [?] Winsor McCay? / Standard 35mm spherical 1.33:1 format. / [?] The film is thought to have been produced between and 1921; Website-LoC notes the production year as
Watch History of Animation - Origins of American Animation Season 1...
www.yidio.com
Watch History of Animation - Origins of American Animation Season 1 Episode 27 Gertie on Tour [Fragment] online now. Stream the full Gertie on Tour [Fragment]...
Alle Infos zum Namen "Rialto Productions"
Verwandte Suchanfragen zu Rialto Productions
John Fitzsimmons |
Personen Vorname "Rialto" (1) Name "Productions" (174) |
sortiert nach Relevanz / Datum