File:The Centaurs.ogv - Wikimedia Commons
commons.wikimedia.org
CREATED/PUBLISHEDEdit. United States : [Rialto Productions?, 1921] Rialto Productions. AFI/Cinematheque Canadienne Collection (Library of Congress) ...
File:The Centaurs.ogv - Wikimedia Commonscommons.wikimedia.org › wiki › File:The_Centaurs
commons.wikimedia.org
Rialto Productions. AFI/Cinematheque Canadienne Collection (Library of Congress); SemihDTown, For The Sound. MEDIUMBearbeiten. ref print. 1 reel (ca ft ...
Rialto Productions - FilmAffinity
www.filmaffinity.com
Rialto Productions is a multinational conglomerate, know for Gertie on Tour (S), The Centaurs (S), The Flying House (S), The Pet (S), Bug Vaudeville (S), Flip's Circus (S) and Tony Sarg's Almanac: Noah Put the Cat Out (S)
Rialto Productions - Filmaffinitym.filmaffinity.com › name
m.filmaffinity.com
Rialto Productions es un conglomerado multinacional, cuyos títulos más conocidos son Gertie on Tour (C), The Centaurs (C), The Flying House (C), ...
The Centaurs (S) (1921) - FilmAffinity
www.filmaffinity.com
Silent film. Cinematography. Animation (B&W). Cast: Animation; Producer. Rialto Productions. Genre: Animation. Fantasy. Romance | Mythology. Silent Film.
The Centaurs, a Fragment (1921) – anduinel
anduinel.wordpress.com
iconuk01: The only surviving fragment of Winsor McCay’s now lost The Centaurs, produced in by Rialto Productions. This is amazing, the quality is...
Alle Infos zum Namen "Rialto Productions"
Animators: Winsor McCay, John McCay, and John Fitzsimmons. A half...
www.pinterest.de
The Centaurs (1921, Rialto Productions). Animators: Winsor McCay, John McCay , and John Fitzsimmons. A half human-half horse boy and girl meet and fall in ...
The Centaurs, a Fragment (1921) – The Public Domain Review
publicdomainreview.org
The only surviving fragment of Winsor McCay’s now lost The Centaurs, produced in by Rialto Productions.The animation is notable for it’s particular quality of line and movement way ahead of its time (20 years before Disney would reach such heights with Fantasia) and for a strange little moment when one of the centaurs strikes down a bird with a stone for seemingly no reason.
The Centaurs (1921, Rialto Productions) - Pinterestwww.pinterest.ie › amp › pin
www.pinterest.ie
12/out Animators: Winsor McCay, John McCay, and John Fitzsimmons. A half human-half horse boy and girl meet and fall in love. They have a baby and ...
A New Americanismyou.raifinepapa.cf
you.raifinepapa.cf
Fragment from The Centaurs , Rialto Productions. Free American History Essays and Papers. essays about ice hockey. essay on hobbies reading. Subscribe to ...
The Public Domain Review
autoblog.kd2.org
The only surviving fragment of Winsor McCay's now lost The Centaurs, produced in by Rialto Productions. Source: ...
"The Centaur" - Animation from Animated Film Reviewsanimatedfilmreviews.filminspector.com ›
animatedfilmreviews.filminspector.com
· The only surviving fragment of Winsor McCay's now lost The Centaurs, produced in by Rialto Productions. The animation is notable for it's ...
The Centaurs (1921) - Filmweb
www.filmweb.pl
Możesz być pierwszy! Dodaj swoją recenzję. pozostałe informacje o filmie. The Centaurs. studio: Rialto Productions. inne tytuły: (więcej...) ...
The Appendix Tumblr | “The only surviving fragment of Winsor McCay’s...
tumblr.theappendix.net
“The only surviving fragment of Winsor McCay’s now lost The Centaurs, produced in by Rialto Productions. The animation is notable for it’s particular...
[The centaurs--excerpts] | Library of Congresswww.loc.gov › item
www.loc.gov
Rialto Productions. Created / Published. United States : [Rialto Productions?, 1921]. Headings. - Centaurs--Drama; - Courtship--Drama; - Infants--Drama ...
Silent Era : Progressive Silent Film List
www.silentera.com
The Centaurs (191?) American B&W : Short film. Directed by Winsor McCay. Cast: (unknown). Rialto Productions production. / Animation by ...
The Appendix Tumblrtumblr.theappendix.net › page
tumblr.theappendix.net
· “The only surviving fragment of Winsor McCay's now lost The Centaurs, produced in by Rialto Productions. The animation is notable for ...
Verwandte Suchanfragen zu Rialto Productions
John Fitzsimmons |
Personen Vorname "Rialto" (1) Name "Productions" (174) |
sortiert nach Relevanz / Datum