1
0
0
News
Am 16. Februar im Täubchenthal: „The Art of Pole #6“ – Nachrichten...
www.l-iz.de
Am findet im Leipziger Westen „The Art of Pole #6“ statt. Die Plagwitzer Eventlocation „Täubchenthal“ lockt bereits seit vielen Jahren mit ihrem...
A personal touch of - Hanka Venselaar - Radboudumcwww.radboudumc.nl › news › a-personal-touch-of-...
www.radboudumc.nl
· 25 April My name is Hanka Venselaar, Dutch, department of Bioinformatics aka the CMBI, theme Nanomedicine. I study protein structures ...
External Workshop with Hanka Venselaar! - GSPV De Noordpoledenoordpole.nl › event › external-workshop-with-h...
denoordpole.nl
· We organise an external workshop by a big name in the pole dance world every year, this year our workshop will be taught by Hanka Venselaar!
Netzwerk-Profile
LinkedIn: Hanka Venselaar - PostDoc - UMC St Radboud | LinkedIn
Bekijk het profiel van Hanka Venselaar op LinkedIn, de grootste professionele community ter wereld. Hanka Venselaar heeft 3 functies op zijn of haar profiel.
Interessen
Workshops mit Hanka Venselaar
www.wherevent.com
Es ist soweit zum ersten Mal dürfen wir internationalen Gastbesuch bei uns im Studio begrüßen Hanka wird kommen und bei uns ...
Firmen-Mitarbeiter
Über Uns - Aerialistic Body & Soul
www.aerialistic.at
Die Mission: mehr Selbstvertrauen un eine verstärkte, positive Körperwahrnehmung durch Aerial Hammock, Poledance, Stretching, The Art of Teasing, etc.
About Us - NSPV Lasyalasya.nl › about-us
lasya.nl
Hanka Venselaar. Pole dancer, aerialist, performer, but most of all a passionate instructor. In her daily life, she works as bioinformatics at the CMBI.
Private Homepages
Hanka Venselaarwww.hankavenselaar.nl
www.hankavenselaar.nl
op de website van Hanka Venselaar: Paaldans artiest, luchtacrobate, aerialist, performer, en vooral gepassioneerd docent. Wil je op de hoogte blijven van ...
Bücher
bol.com: Vangst, Onno Kosters | | Boeken | bol.comwww.bol.com › ... › Poëzie
... Johannes de Doper en Nausicaä de koningsdochter, dalen we af in de Onderwereld en bewonderen we de paaldanskunsten van bio-informaticus Hanka Venselaar.
Vangst by Onno Kosters
www.goodreads.com
Vangst book. Read reviews from world’s largest community for readers. Van lyriek tot readymade, van elegie tot epos: in Vangst spreken Johannes de Doper ...
Hanka Venselaar | Vitória Piai - Labvitoriapiai.science › author › hanka-venselaar
vitoriapiai.science
Hanka Venselaar. Latest. Heterozygous missense variants of LMX1A lead to nonsyndromic hearing impairment and vestibular dysfunction.
JIMD Reports - Volume 12books.google.com › books
books.google.de
DOI _2013_242 CASE REPORT Jessica Nouws • Flemming Wibrand • Mariël van den Brand • Hanka Venselaar • Morten Duno • Allan M. Lund • Simon ...
Dokumente zum Namen
Hepcidin - SlideSharede.slideshare.net › santosari › hepcidin
de.slideshare.net
... Hans Willems for dis- cussion on assay harmonization; and Hanka Venselaar and Erwin Kemna for their contribution to the figures. References 1.
Structural model of a putrescine-cadaverine permease from ...portlandpress.com › biochemj › article-abstract › Str...
portlandpress.com
Hanka Venselaar;. Hanka Venselaar. †Centre for Molecular and Biomolecular Informatics, Nijmegen Centre for Molecular Life Sciences, UMC Street Radbout ...
Identification of a novel MET mutation in high-grade glioma resulting...
www.scienceopen.com
... Pieter Wesseling, Wiljan J. A. J. Hendriks, Hanka Venselaar, Marco Sign in using LinkedIn | Sign in using Facebook | Sign in using ORCID.
The structure-function relationship of the Aspergillus...
www.scienceopen.com
Authors: E. Verweij, W. Melchers, Hanka Venselaar, Rob Verhoeven, Eveline Snelders, Anna Karawajczyk, Gijs Schaftenaar. Publication date: ...
Wissenschaftliche Veröffentlichungen
Protein structure analysis of mutations causing inheritable diseases ...bmcbioinformatics.biomedcentral.com › articles
bmcbioinformatics.biomedcentral.com
· An e-Science approach with life scientist friendly interfaces. Hanka Venselaar,; Tim AH te Beek, ...
Knockout mice help find gene for bad breath -- ScienceDaily
www.sciencedaily.com
... Rodenburg, Jörn Oliver Sass, K. Otfried Schwab, Hendrik Schäfer, Hanka Venselaar, J. Silvia Sequeira, Huub J. M. Op den Camp, Ron A. Wevers. Mutations in SELENBP1, encoding a novel human methanethiol oxidase, cause extraoral halitosis. Nature Genetics, 2017; DOI: s
Veröffentlichungen allgemein
The alpha-kinase family: an exceptional branch on the protein kinase...
link.springer.com
The alpha-kinase family represents a class of atypical protein kinases that display little sequence similarity to conventional protein kinases. Early studies...
Homology modelling and spectroscopy, a never-ending love storylink.springer.com › article
link.springer.com
· Hanka Venselaar, Robbie P. Joosten, Bas Vroling, Coos A. B. Baakman, Maarten L. Hekkelman, Elmar Krieger & Gert Vriend. Authors.
Video & Audio
2019 PSO Netherlands Pole Champion, Hanka Venselaar - YouTube
www.youtube.com
Hanka Venselaar representing Studio Ad Astra2019 PSO Netherlands gold medalist, Championship Level 5 women’s division2019 PSO Netherlands Pole ChampionshipsD...
Artistic Women Hanka Venselaar Netherlands - Finals Silver World...
ipsf.solidtango.com
The 6th World Pole Championships took place in the Netherlands between 30th June and 2nd July athletes from 36 countries and 5 continents took...
Artikel & Meinungen
Interview with Hanka Venselaar Pole Dancer and Aerial Silks Artistwww.verticalwise.com › interview-with-hanka-vense...
www.verticalwise.com
Hanka Venselaar is a scientist in bioinformatics at the Radboud University. In her free time teaches and performs as a Pole Dancer and Aerial Silks Artist.
Interview with Hanka Venselaar – Pole Motion
www.polemotion.com
We're excited to start the month by talking to the European Champion of Champions Hanka Venselaar ahead of her visit to the UK where she'll be judging at the...
Koers. Betrokkenheid. Pagina 3 Werkplek 2.0: altijd alle gegevens...
docplayer.nl
Eén na beste ziekenhuis 2.0 Het Radboud is na het UMC Utrecht het beste ziekenhuis in gebruik van social media (Twitter, Facebook, LinkedIn). Dat is 1 november bekendgemaakt tijdens een bijeenkomst over ... Hanka Venselaar, donderdag 29 november, uur. Titel: Project HOPE. Providing the last piece of the puzzle ...
Mutations in SMAD3 cause a syndromic form of aortic aneurysms and...
www.nature.com
Aida Bertoli-Avella and colleagues report the identification of SMAD3 mutations in individuals with a syndromic form of aortic aneurysms and dissections with...
Sonstiges
Hanka Venselaar - Google Scholar
scholar.google.nl
Researcher Radboudumc - Geciteerd door - bioinformatica
Applications of Homology Modeling Hanka Venselaar. - ppt download
slideplayer.com
Hearing loss No structure: MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAI ALAFLPLVVTLLVRYRHYFRLLVRTVLLRSLRDCLSGLRI EERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMG...
Workshop bei Hanka Venselaar | Schnittchens Welt
schnittchenswelt.de
Ich habe heute an einem Workshop für Beginners/Intermediate bei Hanka Venselaar teilgenommen. Es war mein erster Pole-Workshop und somit war ich im Vorfeld ziemlich
Applications of Homology Modeling - ppt video online download
slideplayer.com
This seminar…. Homology Modeling… Why? What? When? How? And a few real world examples….
Hanka Venselaar boeken bij Twilight Entertainmenttwilight-entertainment.nl › hanka-venselaar-boeken
www.twilight-entertainment.nl
Biografie Hanka Venselaar. Hanka Venselaar is al vanaf actief tijdens turnwedstrijden. In is vanuit deze hobby de interesse ontstaan om verder te ...
Homology Modeling Seminar produced by Hanka Venselaar. - ppt download
slideplayer.com
Homology modeling in short… Prediction of structure based upon a highly similar structure Add sidechains, Molecular Dynamics simulation on model Unknown...
Workshops mit Hanka Venselaar | Event | Halle
de.eventbu.com
Workshops mit Hanka Venselaar im Halle, Polefriends, Samstag, 15. Juli Workshops mit Hanka Venselaar am Samstag, Hanka has been a competitive...
Hanka Venselaar Archives - Aradia Fitness Calgary
calgary.aradiafitness.com
I had registered for three workshops in the late afternoon with Hanka Venselaar, Michelle Stanek and Oona Kivela. The first workshop with Hanka was a small ...
Hanka Venselaar Gets Accepted into the International Pole Competition...
unitedpoleartists.com
Hanka Venselaar Gets Accepted into the International Pole Competition for 2013! The following is a Facebook post made by the organizers of IPC: “We are ...
Stages avec Hanka Venselaar, le Pole & Dancewww.pole-and-dance.com › stages-avec-hanka-vens...
www.pole-and-dance.com
· Stages avec Hanka Venselaar, le Les dernières news de l'école de ... The moves will be linked in new and creative combinations.
Workshops with Hanka Venselaar- Pole Dance Studio Wrocław - Wroclaw,...
yellow.place
Specjalnie dla Was Wrocław nawiedza jedna z najlepszych i najbardziej popularnych pole dancerek , prawdziwa kobieta rakieta, królowa trików i combosów Hanka...
Workshops mit Hanka Venselaar | Polestructions
polestructions.com
· Großartige Neuigkeiten: Hanka Venselaar kommt zu Polestructions!!! Wir bieten euch zwei Workshops am Samstag, den an:.
411 "Μου αρέσει!", 14 σχόλια - Hanka Venselaar Pinterest
www.pinterest.de
14 σχόλια - Hanka Venselaar (@hankavenselaar) στο Instagram: "Just keep going.... #pole #poledancing #polefitness #poletricks #polemove ...
611 "Μου αρέσει!", 24 σχόλια - Hanka Venselaar Pinterest
www.pinterest.de
611 "Μου αρέσει!", 24 σχόλια - Hanka Venselaar (@hankavenselaar) στο Instagram: "Just playing and preparing for next week's performance at ...
Best Pole Tricks #17 - Back Flip (Hanka Venselaar) | Pole tricks,...
www.pinterest.at
Best Pole Tricks #17 - Back Flip (Hanka Venselaar). Follow us: http://www.facebook.com/poleranking Poleranking brings you the newest pole dance videos from ...
Gefällt 370 Mal, 9 Kommentare - Hanka Venselaar (@hankavenselaar) auf...
www.pinterest.cl
Gefällt 370 Mal, 9 Kommentare - Hanka Venselaar (@hankavenselaar) auf Instagram: „Do you know those days when nothing seems to be working and you feel ...
Homology Modeling Seminar produced by Hanka Venselaar - [PPT...
vdocuments.site
Slide 1 Homology Modeling Seminar produced by Hanka Venselaar Slide 2 Homology modeling # residues % identity * * Actually, modelling is possible here, but we...
CEUR-WS.org/Vol Semantic Web Applications and Tools for Life...
ceur-ws.org
Semantic Web Applications and Tools for Life Sciences ... Andreas Schwarte, Hanka Venselaar, Peter Haase, Gert Vriend; The CombineArchiveWeb Application
1. Leipziger Pole Tage | Event | Leipzig
de.eventbu.com
1. Leipziger Pole Tage im Leipzig, Polexperience Leipzig, Freitag, 16. Februar Mit: Dimitry Politov, Hanka Venselaar, Lea Roth, Rania Pole Angel Ein...
Verwandte Suchanfragen zu Hanka Venselaar
| Onno Kosters Hendrik Schäfer Peter Haase | Andreas Schwarte Emma Haslam Doris Arnold | Imran Khan Oliver Sass |
Personen Vorname "Hanka" (406) Name "Venselaar" (2) |
sortiert nach Relevanz / Datum